DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and ppp1cbl

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_956210.1 Gene:ppp1cbl / 334597 ZFINID:ZDB-GENE-030131-6529 Length:281 Species:Danio rerio


Alignment Length:294 Identity:182/294 - (61%)
Similarity:215/294 - (73%) Gaps:49/294 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NIDQLILRIIDTRRL---KQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDL 74
            ::|.||.|:::.|..   |.:.:||.::|.||.:|||:|:|||:||||                 
Zfish     7 DVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLEL----------------- 54

  Fly    75 LRLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFY 139
                                         ||:||||||||||||||||||||||.|.||||||||
Zfish    55 -----------------------------ETICLLLAYKIKYPENFFLLRGNHECASINRIYGFY 90

  Fly   140 DECKRRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLC 204
            ||||||:.||||:||.||::|:|::||||||||||||||||||.:|.||.::.||.||||.||||
Zfish    91 DECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLC 155

  Fly   205 DLLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIF 269
            ||||||||..:.||.:||||||.|||||:|.||::||..||||||||||||||||||||||:|:|
Zfish   156 DLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLF 220

  Fly   270 SAPNYCGEFDNAGAMMSVDETLMCSFYVLKPSKK 303
            |||||||||||||.||||||||||||.:||||:|
Zfish   221 SAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 181/292 (62%)
MPP_PP1_PPKL 13..300 CDD:277359 178/289 (62%)
ppp1cblNP_956210.1 PTZ00480 3..254 CDD:185658 181/292 (62%)
MPP_superfamily 7..251 CDD:301300 178/289 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.