DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and Ppef1

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_038955765.1 Gene:Ppef1 / 317498 RGDID:1562772 Length:664 Species:Rattus norvegicus


Alignment Length:393 Identity:105/393 - (26%)
Similarity:169/393 - (43%) Gaps:83/393 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLQMTTLTELNNIDQ-LILRIIDTRRLK----------------------QLNLTETDIRLLCN- 42
            |..:...|..:..|. |:.|:.:..||:                      |..||.|||.||.. 
  Rat    88 SFMLENYTNTHKEDSALVSRLFENTRLESKDREEYVGLIDVPDSYDGPRLQFPLTFTDINLLLQA 152

  Fly    43 -----------------RSREVFMSQPMLLELSA-PVK---ICGDIHGQFTDLLRLFDYGGYPPA 86
                             .:|::....|....:.. |.|   ||||:||:..||:.:|...|.|..
  Rat   153 FKQQQTLHAHYVLEVLFEARKILKQMPNFTRIQTFPAKEITICGDLHGKLDDLMLIFYKNGLPSE 217

  Fly    87 SN-YLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYDECKRRYTI-- 148
            .| |:|.||:||||..|:|.:.:||...:.||.:..|.|||||...:|..|||..|..::|.:  
  Rat   218 KNPYVFNGDFVDRGNNSMEILMILLVSFLVYPTDLHLNRGNHEDFMMNLRYGFTKEILQKYKLHG 282

  Fly   149 -KLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLAR---------------PCDV 197
             |:.:...:.|:.:|:..|:|.:|...|||:| :..::|.:.||.|               .|::
  Rat   283 KKILQVLEELYTWLPIGTIIDNEILVIHGGIS-ESTDLNILQQLQRNKMKSVLMPPMSTNQECNI 346

  Fly   198 PDKGL------------------LCDLLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFD 244
            .....                  :.|||||||..|...:.:..||....||.|:..|.:::::..
  Rat   347 KKNKAGPSEQSASEQLTKLEWEQIIDLLWSDPRGKKGCYPNTSRGGGCYFGPDVTSKVLNKNQLK 411

  Fly   245 LICRAHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNAGAMMSVDETLMCSFYVLKPSKKPGLRKI 309
            ::.|:|:...||||.....::||:|||.||..|..|.||.:.:.......|:..:.:....|..:
  Rat   412 MVIRSHECKPDGYEICHDGKVITVFSASNYYEEGSNRGAYIRLSYGTSPQFFQYQVTSTSCLNPL 476

  Fly   310 HSK 312
            :.:
  Rat   477 YQR 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 102/374 (27%)
MPP_PP1_PPKL 13..300 CDD:277359 102/368 (28%)
Ppef1XP_038955765.1 IQ 40..>57 CDD:197470
MPP_RdgC 140..466 CDD:277364 96/326 (29%)
PTZ00183 505..647 CDD:185503
EF-hand_7 582..650 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.