DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and PpV

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster


Alignment Length:269 Identity:109/269 - (40%)
Similarity:169/269 - (62%) Gaps:4/269 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IIDTRRLKQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDLLRLFDYGGYPP 85
            |.|.::.|.  |.|.:::.||....::.:.:..:|.:|.||.:||||||||.||.:||..||..|
  Fly     8 IEDVKKCKY--LPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRTGGQVP 70

  Fly    86 ASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYDECKRRY-TIK 149
            .:||:|:||:||||..|:||...||..|.:||....|||||||:..|.::|||:|||..:| ...
  Fly    71 HTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNAN 135

  Fly   150 LWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLCDLLWSDPDPK 214
            .|:.....:..:.::||:||::.|.||||||:::.::||..:.|..::|.||..|||:||||: .
  Fly   136 GWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWSDPE-D 199

  Fly   215 IMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIFSAPNYCGEFD 279
            :..|..:.||....||.::...|:..:..:|||||||:|.:|.::....:|:|::||||||....
  Fly   200 MEYWGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYCYRCG 264

  Fly   280 NAGAMMSVD 288
            |..|::|.:
  Fly   265 NVAAILSFE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 109/269 (41%)
MPP_PP1_PPKL 13..300 CDD:277359 109/269 (41%)
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 109/269 (41%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 109/269 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438759
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.