DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and dis2

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_596317.1 Gene:dis2 / 2541193 PomBaseID:SPBC776.02c Length:327 Species:Schizosaccharomyces pombe


Alignment Length:294 Identity:210/294 - (71%)
Similarity:258/294 - (87%) Gaps:0/294 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ELNNIDQLILRIIDTRRLKQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDL 74
            :|::|...:|.:..:|..:|:.|:|.:||.|||::||:|:|||:||||.||:|||||||||:.||
pombe     7 DLDSIIDRLLEVRGSRPGRQVQLSEDEIRFLCNKAREIFISQPILLELEAPLKICGDIHGQYYDL 71

  Fly    75 LRLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFY 139
            ||||:|||:||.:|||||||||||||||:|.:|||||||||||||||:||||||.|.||||||||
pombe    72 LRLFEYGGFPPEANYLFLGDYVDRGKQSLEVICLLLAYKIKYPENFFILRGNHECASINRIYGFY 136

  Fly   140 DECKRRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLC 204
            |||||||.||||:||.||::|:|::||:|||||..||||||||.:|:||.::.||.||||.||||
pombe   137 DECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLNSMDQIQRIMRPTDVPDTGLLC 201

  Fly   205 DLLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIF 269
            ||||||||..:.||.|||||||.|||.|:|.:|:|:|..||:||||||||||||||:||||:|:|
pombe   202 DLLWSDPDKDLTGWGDNDRGVSFTFGPDVVSRFLHKHDMDLVCRAHQVVEDGYEFFSKRQLVTLF 266

  Fly   270 SAPNYCGEFDNAGAMMSVDETLMCSFYVLKPSKK 303
            ||||||||||||||||||||:|:|||.:|||::|
pombe   267 SAPNYCGEFDNAGAMMSVDESLLCSFQILKPAEK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 209/292 (72%)
MPP_PP1_PPKL 13..300 CDD:277359 206/286 (72%)
dis2NP_596317.1 PTZ00480 5..311 CDD:185658 210/294 (71%)
MPP_PP1_PPKL 7..297 CDD:277359 207/289 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.