DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and Ppp2ca

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_058735.1 Gene:Ppp2ca / 24672 RGDID:3380 Length:309 Species:Rattus norvegicus


Alignment Length:296 Identity:134/296 - (45%)
Similarity:194/296 - (65%) Gaps:7/296 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DQLILRIIDTRRLKQLN----LTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDLL 75
            ::|..:.:| :.::|||    |:|:.::.||.:::|:...:..:.|:..||.:|||:||||.||:
  Rat     3 EKLFTKELD-QWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLM 66

  Fly    76 RLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYD 140
            .||..||..|.:||||:|||||||..|:||:.||:|.|::|.|...:|||||||..|.::|||||
  Rat    67 ELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYD 131

  Fly   141 ECKRRY-TIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLC 204
            ||.|:| ...:|:.|.|.:..:|::|:||.:|||.||||||.:..::.|..|.|..:||.:|.:|
  Rat   132 ECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMC 196

  Fly   205 DLLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIF 269
            ||||||||.: .||..:.||...|||.||...|.|.:...|:.||||:|.:||.:...|.::|||
  Rat   197 DLLWSDPDDR-GGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIF 260

  Fly   270 SAPNYCGEFDNAGAMMSVDETLMCSFYVLKPSKKPG 305
            ||||||....|..|:|.:|:||..||....|:.:.|
  Rat   261 SAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRG 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 133/292 (46%)
MPP_PP1_PPKL 13..300 CDD:277359 132/289 (46%)
Ppp2caNP_058735.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 132/285 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.