DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and Y69E1A.4

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_502041.1 Gene:Y69E1A.4 / 190550 WormBaseID:WBGene00013476 Length:375 Species:Caenorhabditis elegans


Alignment Length:359 Identity:135/359 - (37%)
Similarity:187/359 - (52%) Gaps:63/359 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NIDQLILRIIDTRRLKQLNLTETD------IRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQF 71
            |:...:.:|::....|..:.|..|      :..||:|:||:..|:|:.|:|.||:.:.|||||||
 Worm    11 NVRNFVNKILEKIVFKWTHKTSMDLFCAAELAELCHRARELIWSEPIFLKLEAPICVMGDIHGQF 75

  Fly    72 TDLLRLFDYGGYPPAS------------------------------------------------- 87
            .|||.:.|..|:|.:|                                                 
 Worm    76 DDLLAMLDMNGWPLSSQEFEALKDTTVRSRETGKRPQSEPHSTQPESSNDVKPPVAAPKSVNKEV 140

  Fly    88 -----NYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYDECKRRYT 147
                 .|||||||||||..|:|.:.||.|.|:.||:..:||||||||..:|..||||.|...||.
 Worm   141 TTGYKRYLFLGDYVDRGPFSMEVVILLTALKLAYPDRIYLLRGNHESRSVNTSYGFYREVNYRYD 205

  Fly   148 IKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLCDLLWSDPD 212
            .:|:..|.:.::..|..|:::..|.|.|||:|..|.:.||.....||.::||.|:|.||.|:|||
 Worm   206 AQLYECFQNMFNVFPFCAVINNTIMCMHGGISEHLTSFNQFSVFKRPLEIPDVGVLTDLTWADPD 270

  Fly   213 PKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIFSAPNYCGE 277
            |...|:..:.||.|..||...:..|:.:....::.|.|||||||||||..|:|:||||||||||:
 Worm   271 PTEKGYKPSARGASFVFGPPALRAFLKKLDLQMVIRGHQVVEDGYEFFDGRRLVTIFSAPNYCGQ 335

  Fly   278 FDNAGAMMSVDETLMCSFYVLKP---SKKPGLRK 308
            .||..|:.|:|:.|..|..|.:|   .||.|..|
 Worm   336 NDNTAAVFSIDKKLKISINVFRPESRDKKRGFEK 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 131/352 (37%)
MPP_PP1_PPKL 13..300 CDD:277359 130/346 (38%)
Y69E1A.4NP_502041.1 PP2Ac 36..360 CDD:197547 126/323 (39%)
MPP_superfamily 39..358 CDD:301300 125/318 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.