DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and Ppp1cc

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_006530263.1 Gene:Ppp1cc / 19047 MGIID:104872 Length:337 Species:Mus musculus


Alignment Length:297 Identity:224/297 - (75%)
Similarity:261/297 - (87%) Gaps:5/297 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NIDQLILRIIDTRRL---KQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDL 74
            |||.:|.|:::.|..   |.:.|.|.:||.||.:|||:|:|||:||||.||:|||||||||:.||
Mouse     8 NIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDL 72

  Fly    75 LRLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFY 139
            ||||:|||:||.||||||||||||||||:||:||||||||||||||||||||||.|.||||||||
Mouse    73 LRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFY 137

  Fly   140 DECKRRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLC 204
            |||||||.||||:||.||::|:|::||||||||||||||||||.:|.||.::.||.||||:||||
Mouse   138 DECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLC 202

  Fly   205 DLLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIF 269
            ||||||||..::||.:||||||.||||::|.||:|:|..||||||||||||||||||||||:|:|
Mouse   203 DLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLF 267

  Fly   270 SAPNYCGEFDNAGAMMSVDETLMCSFYVLKPS--KKP 304
            ||||||||||||||||||||||||||.:|||:  |||
Mouse   268 SAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 221/294 (75%)
MPP_PP1_PPKL 13..300 CDD:277359 219/289 (76%)
Ppp1ccXP_006530263.1 MPP_PP1_PPKL 8..298 CDD:277359 219/289 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.