DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and Ppp1cb

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_766295.2 Gene:Ppp1cb / 19046 MGIID:104871 Length:327 Species:Mus musculus


Alignment Length:294 Identity:221/294 - (75%)
Similarity:259/294 - (88%) Gaps:3/294 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NIDQLILRIIDTRRL---KQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDL 74
            |:|.||.|:::.|..   |.:.:||.::|.||.:|||:|:|||:||||.||:|||||||||:|||
Mouse     7 NVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDL 71

  Fly    75 LRLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFY 139
            ||||:|||:||.:|||||||||||||||:||:||||||||||||||||||||||.|.||||||||
Mouse    72 LRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFY 136

  Fly   140 DECKRRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLC 204
            ||||||:.||||:||.||::|:|::||||||||||||||||||.:|.||.::.||.||||.||||
Mouse   137 DECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLC 201

  Fly   205 DLLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIF 269
            ||||||||..:.||.:||||||.|||||:|.||::||..||||||||||||||||||||||:|:|
Mouse   202 DLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLF 266

  Fly   270 SAPNYCGEFDNAGAMMSVDETLMCSFYVLKPSKK 303
            |||||||||||||.||||||||||||.:||||:|
Mouse   267 SAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 220/292 (75%)
MPP_PP1_PPKL 13..300 CDD:277359 217/289 (75%)
Ppp1cbNP_766295.2 MPP_PP1_PPKL 7..297 CDD:277359 217/289 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.