DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and Ppp1ca

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_114074.1 Gene:Ppp1ca / 19045 MGIID:103016 Length:330 Species:Mus musculus


Alignment Length:316 Identity:226/316 - (71%)
Similarity:266/316 - (84%) Gaps:15/316 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TELNNIDQLILRIID---TRRLKQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQ 70
            :|..|:|.:|.|:::   :|..|.:.|||.:||.||.:|||:|:|||:||||.||:|||||||||
Mouse     4 SEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQ 68

  Fly    71 FTDLLRLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRI 135
            :.||||||:|||:||.||||||||||||||||:||:||||||||:|||||||||||||.|.||||
Mouse    69 YYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINRI 133

  Fly   136 YGFYDECKRRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDK 200
            |||||||||||.||||:||.||::|:|::||||||||||||||||||.:|.||.::.||.||||:
Mouse   134 YGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQ 198

  Fly   201 GLLCDLLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQL 265
            ||||||||||||..:.||.:||||||.||||::|.||:|:|..||||||||||||||||||||||
Mouse   199 GLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263

  Fly   266 ITIFSAPNYCGEFDNAGAMMSVDETLMCSFYVLKPSKK------------PGLRKI 309
            :|:|||||||||||||||||||||||||||.:|||:.|            ||.|.|
Mouse   264 VTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPI 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 221/295 (75%)
MPP_PP1_PPKL 13..300 CDD:277359 218/289 (75%)
Ppp1caNP_114074.1 PTZ00480 6..308 CDD:185658 221/301 (73%)
MPP_PP1_PPKL 8..298 CDD:277359 218/289 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..330 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S19
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.