DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and R08A2.2

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_506632.2 Gene:R08A2.2 / 187692 WormBaseID:WBGene00011133 Length:371 Species:Caenorhabditis elegans


Alignment Length:309 Identity:121/309 - (39%)
Similarity:179/309 - (57%) Gaps:12/309 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLQMTTLTELNNIDQLILRIIDTRRLKQLNLTET----DIRLLCNRSREVFMSQPMLLELSAPV 61
            |..|...|.|..::|||..|:|:  .|.:..:|:.    .|..:..::.......|.:|::..|:
 Worm     3 MESQKGDLYEGESVDQLAKRMIE--HLLKWGVTDAFNDKQIYTILEKAESTLNPLPAMLQVEHPI 65

  Fly    62 KICGDIHGQFTDLLRLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGN 126
            .|.||||||...|:|.||..||||...:||||||||||.:|.|...||..|||:||.:..|||||
 Worm    66 TIVGDIHGQLDALIRYFDAVGYPPKVKFLFLGDYVDRGAKSFEVSLLLFCYKIRYPHSVHLLRGN 130

  Fly   127 HESAGINRIYGFYDECKRRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQL 191
            ||...:||:||||:|..|:...::||.:.:.::.:|:.|.|.::|.|.|||:|.:..:......|
 Worm   131 HECMKMNRLYGFYEELARKRGGRMWRQYQNVFNELPLCARVGQRILCMHGGISQNCNSWESFKAL 195

  Fly   192 ARPCDVP---DKGLLCDLLWSDP-DPKIMGWSDN-DRGVSVTFGADIVGKFVHRHKFDLICRAHQ 251
            .:| :.|   |:||..||:|:|| ..|...::.| .|.:||.||...:..|:.:....||.|||:
 Worm   196 KKP-NTPLTCDEGLQVDLMWADPTQDKCNTFAMNKQRAISVVFGEKGLDVFLKKLGLSLIVRAHE 259

  Fly   252 VVEDGYEFFAKRQLITIFSAPNYCGEFDNAGAMMSVDETLMCSFYVLKP 300
            |.::|:.|...::.:|:||||.|||...|.||:|.|.|:...||.||:|
 Worm   260 VSQEGFNFLFNKKCVTVFSAPYYCGNDTNCGAIMHVSESYEISFTVLRP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 118/300 (39%)
MPP_PP1_PPKL 13..300 CDD:277359 116/295 (39%)
R08A2.2NP_506632.2 PP2Ac 36..308 CDD:197547 109/272 (40%)
MPP_PPP_family 66..295 CDD:277316 99/229 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.