DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and F44B9.9

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001367454.1 Gene:F44B9.9 / 185726 WormBaseID:WBGene00018410 Length:254 Species:Caenorhabditis elegans


Alignment Length:280 Identity:91/280 - (32%)
Similarity:129/280 - (46%) Gaps:78/280 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDLLRLFD-------------YGGYP 84
            ::|::..|.:...|:|..:..|.|:|.||.|.|||||||.||:||.:             ||.  
 Worm     5 SKTELFCLLDMVIELFKKEKTLAEISPPVTIVGDIHGQFEDLVRLLNTRNSSENAKSKPIYGF-- 67

  Fly    85 PASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYDECKRRYTIK 149
            ....::|||||||||.:|::.:||:.:.||.:|:.:.|||||||:..||..|||           
 Worm    68 STKKWVFLGDYVDRGYKSLDCICLVFSLKICFPKQYILLRGNHETRAINFRYGF----------- 121

  Fly   150 LWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLCDLLWSDPDPK 214
                        .|.::|..||        |           |:|..:                 
 Worm   122 ------------RVCSVVVLKI--------P-----------AKPSFI----------------- 138

  Fly   215 IMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIFSAPNYCGEFD 279
                .:|.||:||.|....|.:........||.|.||::..|::|||.|:|.||||||.|..|.|
 Worm   139 ----RNNKRGLSVCFNEAAVNETCRLLNISLIVRGHQMMPAGFKFFADRKLCTIFSAPRYMNEID 199

  Fly   280 NAGAMMSVDETLMCSFYVLK 299
            |:||:|.|......|..::|
 Worm   200 NSGAVMKVASNGKISISIMK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 91/280 (33%)
MPP_PP1_PPKL 13..300 CDD:277359 91/280 (33%)
F44B9.9NP_001367454.1 MPP_superfamily 4..219 CDD:417454 90/278 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.