DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and pph-6

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_497714.2 Gene:pph-6 / 183199 WormBaseID:WBGene00007922 Length:331 Species:Caenorhabditis elegans


Alignment Length:300 Identity:117/300 - (39%)
Similarity:178/300 - (59%) Gaps:15/300 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLQMTTLTELNNIDQLILRIIDTRRLKQLN----------LTETDIRLLCNRSREVFMSQPMLLE 56
            :|...|:.:...:::.....|.:|:::...          |.|:|...||....:....:..::.
 Worm     5 NLLRVTVCDEGELEKSTTHFIGSRKIEPEQWITWASECKYLPESDAVALCATLIDRLSLEANVVP 69

  Fly    57 LSAPVKICGDIHGQFTDLLRLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFF 121
            :|:||.|||||||||.|||.||..||..|.:.|:|:|||||||..|:||:.||....:|||....
 Worm    70 VSSPVTICGDIHGQFYDLLELFKTGGTVPNTKYVFMGDYVDRGHYSLETVTLLFCLLLKYPNQIT 134

  Fly   122 LLRGNHESAGINRIYGFYDECKRRY---TIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLL 183
            ||||||||..|:.:|||||||:.:|   .:..|  |...:..:|:.|::||.:.|.|||||||:.
 Worm   135 LLRGNHESRRISNVYGFYDECQNKYGHGNVHKW--FCKVFDVLPIGALIDESVLCVHGGLSPDIR 197

  Fly   184 NMNQIGQLARPCDVPDKGLLCDLLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICR 248
            .::.:..|.|..:||:||.|||::|||||..:..|..:.||....|||.:..:|:..:...|:||
 Worm   198 TIDSLMLLDRAQEVPNKGPLCDIMWSDPDDDVEDWVISQRGAGFVFGAKVTEEFLMNNDLSLLCR 262

  Fly   249 AHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNAGAMMSVD 288
            :||:|::|:::....:|.|::||||||....||.|:..:|
 Worm   263 SHQLVDEGFKYMFNEKLATVWSAPNYCYRCGNAAAVFEID 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 114/291 (39%)
MPP_PP1_PPKL 13..300 CDD:277359 114/288 (40%)
pph-6NP_497714.2 MPP_PP2A_PP4_PP6 31..315 CDD:277360 112/273 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.