DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and pph-5

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001367002.1 Gene:pph-5 / 180263 WormBaseID:WBGene00012665 Length:496 Species:Caenorhabditis elegans


Alignment Length:278 Identity:110/278 - (39%)
Similarity:170/278 - (61%) Gaps:8/278 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QLILRIIDTRRLKQLNLTETDIRLLCNRSREVFMSQPMLLELSAPV----KICGDIHGQFTDLLR 76
            :.:|::|.|.:.:|....:...::|......| .|.|.::|::.|.    .||||:||||.||..
 Worm   188 EFVLQLIKTFKNQQKLHKKYAFKMLLEFYNYV-KSLPTMVEITVPTGKKFTICGDVHGQFYDLCN 251

  Fly    77 LFDYGGYPPASN-YLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYD 140
            :|:..|||..:| |||.||:||||..|:||:..::.:|:.||.:||:.||||||..:|::|||..
 Worm   252 IFEINGYPSETNPYLFNGDFVDRGSFSVETIFTMIGFKLLYPNHFFMSRGNHESDVMNKMYGFEG 316

  Fly   141 ECKRRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGL-SPDLLNMNQIGQLARPCDVPDKGLLC 204
            |.|.:||.::...|.:.:..:|:..:::||||.||||| ..|.:.:..|.:..|....||:|::|
 Worm   317 EVKAKYTQQMCDMFTETFCWLPLCHLINEKIFVCHGGLFKEDGVTLEDIRKTDRNRQPPDEGIMC 381

  Fly   205 DLLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIF 269
            |||||||.| |.|.|.:.|||...||.|:..|:...:..:.:.|:|:|..:|||.....|..|:|
 Worm   382 DLLWSDPQP-INGRSPSKRGVGCQFGPDVTSKWCETNGIEYVVRSHEVKPEGYEMHHNGQCFTVF 445

  Fly   270 SAPNYCGEFDNAGAMMSV 287
            ||||||.:.:|.||.:::
 Worm   446 SAPNYCDQMNNKGAFITI 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 110/278 (40%)
MPP_PP1_PPKL 13..300 CDD:277359 110/278 (40%)
pph-5NP_001367002.1 PLN03088 29..>139 CDD:215568
TPR repeat 33..57 CDD:276809
TPR repeat 62..91 CDD:276809
TPR repeat 96..124 CDD:276809
MPP_PP5_C 176..490 CDD:277362 110/278 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.