DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and C25A6.1

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_504432.3 Gene:C25A6.1 / 178923 WormBaseID:WBGene00016081 Length:300 Species:Caenorhabditis elegans


Alignment Length:305 Identity:148/305 - (48%)
Similarity:207/305 - (67%) Gaps:25/305 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IDQLILRIIDT---RRLKQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDLL 75
            :|.:|:.::..   .:|....:||..:..|.:.:.:||..|..::|::||:|:||||||||.|||
 Worm     6 VDNIIIDVLSASTHEKLLSEVITEGRVLKLLDLALDVFKRQKSMVEMNAPIKVCGDIHGQFPDLL 70

  Fly    76 RLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYD 140
            |||..||:||.:||||||||||||:.||||:.||||||:|:|.|.||||||||...:|::||||:
 Worm    71 RLFHRGGWPPTANYLFLGDYVDRGRFSIETIVLLLAYKVKFPGNLFLLRGNHECEFVNKVYGFYE 135

  Fly   141 ECKRRY-TIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLC 204
            ||::|| :::::..|.|.::.:|:..::..||.|.||||||     :..|:         :.|:.
 Worm   136 ECQKRYQSVRMFTAFQDVFNWLPLCGLIANKILCMHGGLSP-----SHDGK---------ERLVA 186

  Fly   205 DLLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIF 269
            ||||:||...:.|:.:|:||....||.|.|.|.....|.||||||||||:|||||||.|:|:|||
 Worm   187 DLLWADPISGLSGFMENNRGAGCGFGRDAVLKVCSDFKLDLICRAHQVVQDGYEFFAGRKLVTIF 251

  Fly   270 SAPNYCGEFDNAGAMMSVDETLMCSFYVLKPS-------KKPGLR 307
            |||:|||:|||..|.||.||.|.|||.:|:|:       :||.|:
 Worm   252 SAPHYCGQFDNCAAFMSCDEKLQCSFEILRPTSGRLEVREKPLLK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 145/299 (48%)
MPP_PP1_PPKL 13..300 CDD:277359 144/289 (50%)
C25A6.1NP_504432.3 MPP_superfamily 5..282 CDD:301300 144/289 (50%)
PP2Ac 32..284 CDD:197547 140/265 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.