DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and ZC477.2

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_501111.2 Gene:ZC477.2 / 177485 WormBaseID:WBGene00022617 Length:374 Species:Caenorhabditis elegans


Alignment Length:313 Identity:103/313 - (32%)
Similarity:159/313 - (50%) Gaps:38/313 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NLTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDLLR---------LFDYGGYPPA 86
            ||:..::..:|....:.|..:..|:|:||||.:.||:||.|.||.|         :.|    ...
 Worm    51 NLSSNEVWSVCRAVIDEFKKEQNLMEVSAPVTVIGDVHGNFHDLYRALLARTEQDITD----EQK 111

  Fly    87 SN----------YLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGIN--RIYGFY 139
            ||          |:|||:|:|:|.:|||.:|||.|:||.:|:.:.||||.||...:|  ...|..
 Worm   112 SNFSTRQFVRDKYVFLGNYIDKGPRSIECICLLFAFKICFPQKYILLRGPHECPSVNSSEFLGVM 176

  Fly   140 DECKRRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPC-DVPDKGLL 203
            :.....:..|:.:.|.:.:|.||::|:|.:||.|.|||:||.|.:...|.::.||. |..:..|.
 Worm   177 ETFSPNHFKKIHKKFNEAFSWMPLAAVVGQKILCVHGGISPRLTSWEDIRKIKRPLKDATEDPLA 241

  Fly   204 CDLLWSD---------PDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEF 259
            .|||::|         |..|.....:..|.:||.:....|.:|..:....||.|:|..|..||.|
 Worm   242 TDLLFADTLDFDLIHIPTRKPKYEFNVIRNMSVMYNEAAVTQFCEKFNLKLIIRSHMKVPFGYRF 306

  Fly   260 FAKRQLITIFSAPNYCGEFDNAGAMMSVDETLMCSFYVLKP--SKKPGLRKIH 310
            |::::|||||::..:..| .|.||::.:|.....:...|.|  ||.....|.|
 Worm   307 FSEKRLITIFNSTGFQNE-SNYGAVLKIDGNAKITIISLLPQQSKAEVQEKAH 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 100/304 (33%)
MPP_PP1_PPKL 13..300 CDD:277359 98/299 (33%)
ZC477.2NP_501111.2 PP2Ac 52..348 CDD:197547 98/300 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.