DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and pef-1

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_741091.1 Gene:pef-1 / 175257 WormBaseID:WBGene00003969 Length:707 Species:Caenorhabditis elegans


Alignment Length:316 Identity:106/316 - (33%)
Similarity:155/316 - (49%) Gaps:54/316 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IRLLCNRSREVFMSQPMLLELSA----PVKICGDIHGQFTDLLRLFDYGGYPPASN-YLFLGDYV 96
            :.::.:.:|::|.:.|.:..:|.    .|.||||:||:|.||..:....|||...| |:|.||:|
 Worm   223 VLMILHEARKIFKAMPSVSRISTSISNQVTICGDLHGKFDDLCIILYKNGYPSVDNPYIFNGDFV 287

  Fly    97 DRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYDECKRRY---TIKLWRTFVDCY 158
            |||.||||.:|:|.|..|..|.:.:|.|||||...:|..|||..|...:|   :..:.|...|.:
 Worm   288 DRGGQSIEVLCVLFALVIVDPMSIYLNRGNHEDHIMNLRYGFIKELSTKYKDLSTPITRLLEDVF 352

  Fly   159 SCMPVSAIVDEKIFCCHGGLSP-------DLLNMNQIGQLARPCDVP-DKGL------------- 202
            |.:|::.|:|..||..|||:|.       |.:..::...:.||   | :||:             
 Worm   353 SWLPIATIIDRDIFVVHGGISDQTEVSKLDKIPRHRFQSVLRP---PVNKGMESEKENSAVNVDE 414

  Fly   203 ---LCDLLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQ 264
               :.|::||||......|.:..||....|||||...|:.:|.|.|:.|:|:...:||||.....
 Worm   415 WKQMLDIMWSDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSHNNT 479

  Fly   265 LITIFSAPNYCGEFDNAGAMMSVDETLMCSFYV--LKPSKKPGL-----RKIHSKS 313
            .:|:|||.||.....|.||            ||  :..||:|..     .|.|.||
 Worm   480 CLTVFSASNYYETGSNRGA------------YVKFIGKSKQPHFVQYMASKTHRKS 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 100/299 (33%)
MPP_PP1_PPKL 13..300 CDD:277359 99/296 (33%)
pef-1NP_741091.1 MPP_RdgC 199..515 CDD:277364 102/306 (33%)
PP2Ac 218..514 CDD:197547 102/305 (33%)
EFh 634..699 CDD:238008
EF-hand_7 634..698 CDD:290234
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.