DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and C06A1.3

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_496276.1 Gene:C06A1.3 / 174626 WormBaseID:WBGene00007354 Length:364 Species:Caenorhabditis elegans


Alignment Length:291 Identity:132/291 - (45%)
Similarity:182/291 - (62%) Gaps:13/291 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LKQLNLTETDIRL-LCN-----------RSRE-VFMSQPMLLELSAPVKICGDIHGQFTDLLRLF 78
            :|::|....|..: :||           |..| :||.:..|.|..||:|:.||||.|:.|:.|||
 Worm    41 IKRMNSLYKDTNINICNVMTGHEIISIIRMVEAIFMEESNLCEAEAPIKVIGDIHAQYQDMNRLF 105

  Fly    79 DYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYDECK 143
            |..|..|....:|||||||||.|.||.:.||...||:|.:..:|||||||:..:|:|||||.||:
 Worm   106 DLIGRVPEEKLMFLGDYVDRGPQGIEVLILLFCLKIRYRDRIYLLRGNHETPSVNKIYGFYVECQ 170

  Fly   144 RRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLCDLLW 208
            .:|.|.||..|..|::.||:|.::.:::.|.||||||:|:|::.|..:.|||:..|:|||.||||
 Worm   171 YKYGIGLWWDFQSCFNRMPMSGLISKRVLCMHGGLSPELINLDTIRNIPRPCEPLDRGLLIDLLW 235

  Fly   209 SDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIFSAPN 273
            |||..|..||..:.||:|..||..:|.:.....:.|||.||||||:||||....|:|||:||.||
 Worm   236 SDPTNKGEGWFHSIRGISYMFGKGVVEQACKSLEIDLIIRAHQVVQDGYEMMTGRRLITVFSVPN 300

  Fly   274 YCGEFDNAGAMMSVDETLMCSFYVLKPSKKP 304
            ||.:|.||.|::.::..|..||..:.|...|
 Worm   301 YCAQFTNAAAVVCLNANLQISFQQMIPPPLP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 131/288 (45%)
MPP_PP1_PPKL 13..300 CDD:277359 130/285 (46%)
C06A1.3NP_496276.1 MPP_superfamily 37..327 CDD:301300 130/285 (46%)
PP2Ac 59..329 CDD:197547 126/269 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.