DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and F40E3.5

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001370693.1 Gene:F40E3.5 / 171824 WormBaseID:WBGene00018232 Length:344 Species:Caenorhabditis elegans


Alignment Length:271 Identity:77/271 - (28%)
Similarity:120/271 - (44%) Gaps:32/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDLLRLFDYG-GYPPASNYLFLGDYVDRGK 100
            ::.|..:|.||.....|:::::.|..|.|.::|:...::.|.... ..||...|:.||.|:.||.
 Worm    55 LKKLLQKSCEVLKQDEMVVKVTGPAVIFGPVYGEGDSMISLMSLAKKVPPEQTYVMLGCYLGRGF 119

  Fly   101 QSIETMCLLLAYKIKYPENFFLLRGNHESA---------------GINRIYGFYDECKRRYTIKL 150
            ..||.:..||||||.:||...||:|:||.:               ||.|.... :||    .|::
 Worm   120 AQIECLVFLLAYKILHPEKVVLLKGHHEESISIEMLKVKEWLMARGIERDVDL-EEC----MIEM 179

  Fly   151 WRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLN---MNQIGQLARPCDVPDKGLLCDLLWSDPD 212
            .|.   | |.|..:|::|.||.|..||..|.:..   ...:|.......:.||.||.:..||   
 Worm   180 KRA---C-SMMSAAAVIDSKILCMPGGPGPTIREKGLQKLVGLKKGVQAIADKKLLMEASWS--- 237

  Fly   213 PKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIFSAPNYCGE 277
            ..::..:..|......|.......|...:....|.|..|:|::|| ....|:::|:.||..|...
 Worm   238 VLLLDDAQKDMHGMPFFTPQQATDFCKANNLKCIVRGRQMVDEGY-LNKPREVVTLISAVAYLDN 301

  Fly   278 FDNAGAMMSVD 288
            |.|..|::.||
 Worm   302 FRNHAAVLQVD 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 77/271 (28%)
MPP_PP1_PPKL 13..300 CDD:277359 77/271 (28%)
F40E3.5NP_001370693.1 PP2Ac 50..338 CDD:197547 77/271 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.