DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and Ppp3cc

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_008769035.1 Gene:Ppp3cc / 171378 RGDID:621616 Length:515 Species:Rattus norvegicus


Alignment Length:281 Identity:104/281 - (37%)
Similarity:162/281 - (57%) Gaps:20/281 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ETDIRL-LCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDLLRLFDYGGYPPASNYLFLGDYVD 97
            |.|:.| :.|....:...:..:||:.||:.:|||:||||.||::||:.||.|..:.|||||||||
  Rat    53 EEDVALKIINDGAAILKQEKTMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPSNTRYLFLGDYVD 117

  Fly    98 RGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYDECKRRYTIKLWRTFVDCYSCMP 162
            ||..|||.:..|.:.||.:|:..||||||||...:...:.|..||:.:|:..::...:..:.|:|
  Rat   118 RGYFSIECVLYLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECRIKYSELVYEACMHTFDCLP 182

  Fly   163 VSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLCDLLWSDP------DPKIMGWSDN 221
            ::|:::::..|.|||:||::..::.|.:|.|..:.|..|.:||||||||      :..:..::.|
  Rat   183 LAALLNQQFLCVHGGMSPEITCLDDIRKLDRFAEPPAFGPVCDLLWSDPLEDYGSEKTLEHYTHN 247

  Fly   222 D-RGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQ------LITIFSAPNYCGEFD 279
            . ||.|..|....|.:|:..:....|.|||:..:.||..:.|.|      ||||||||||...::
  Rat   248 TVRGCSYFFSYPAVCEFLQNNSLLSIIRAHEAQDAGYRMYRKNQATGFPSLITIFSAPNYLDVYN 312

  Fly   280 NAGAMMSVDETLM------CS 294
            |..|::..:..:|      ||
  Rat   313 NKAAVLKYENNVMNIRQFNCS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 104/281 (37%)
MPP_PP1_PPKL 13..300 CDD:277359 104/281 (37%)
Ppp3ccXP_008769035.1 MPP_PP2B 37..341 CDD:277361 104/281 (37%)
PP2Ac 54..325 CDD:197547 100/270 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.