DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and ppp3cb

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_012813808.1 Gene:ppp3cb / 100037840 XenbaseID:XB-GENE-949827 Length:531 Species:Xenopus tropicalis


Alignment Length:295 Identity:106/295 - (35%)
Similarity:167/295 - (56%) Gaps:19/295 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LRIIDTRRLKQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDLLRLFDYGGY 83
            |..:....:|:..|.|.....:......:...:..:||:.||:.:||||||||.||::||:.||.
 Frog    65 LETLKNHLIKEGRLEEEAALRIIREGAAILRQEKTMLEVEAPITVCGDIHGQFFDLMKLFEVGGT 129

  Fly    84 PPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYDECKRRYTI 148
            |..:.|||||||||||..|||.:..|.:.||.:|:..||||||||...:...:.|..|||.:|:.
 Frog   130 PHNTRYLFLGDYVDRGYFSIECVLYLWSLKIIHPKTLFLLRGNHECRHLTEYFTFKQECKIKYSE 194

  Fly   149 KLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLCDLLWSDP-- 211
            :::.:.:|.:.|:|::|:::::..|.||||||::..::.|.:|.|..:.|..|.:||||||||  
 Frog   195 RVYDSCMDAFDCLPLAALLNQQFLCVHGGLSPEITCLDDIRKLDRFKEPPAFGPMCDLLWSDPAE 259

  Fly   212 ----DPKIMGWSDND-RGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQ------L 265
                :..:..::.|. ||.|..:....|.:|:..:....:.|||:..:.||..:.|.|      |
 Frog   260 DYGSEKTLEHFTHNTVRGCSYFYSYPAVCEFLQSNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSL 324

  Fly   266 ITIFSAPNYCGEFDNAGAMMSVDETLM------CS 294
            |||||||||...::|..|::..:..:|      ||
 Frog   325 ITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCS 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 106/295 (36%)
MPP_PP1_PPKL 13..300 CDD:277359 106/295 (36%)
ppp3cbXP_012813808.1 MPP_PP2B 63..367 CDD:277361 106/295 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.