DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and NRE1

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_012301.3 Gene:NRE1 / 854853 SGDID:S000001474 Length:254 Species:Saccharomyces cerevisiae


Alignment Length:199 Identity:50/199 - (25%)
Similarity:93/199 - (46%) Gaps:20/199 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VAVVTGASSGIGAAITRKLIS--AGVMVVALARRMDRLEQLREELPQDRRSRLRIMQCDVSDVSS 70
            |.:|||.|.|||.:|...|.|  ...:|..:||....|::|:|:.    ..|...:..|:::.|.
Yeast     4 VILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKY----GDRFFYVVGDITEDSV 64

  Fly    71 VNAVFDAVQGDLGNVDILINNAGKLSGGQLLT-MSVDTVQQMLQTNVMGVVYCTQRAFESMRQRQ 134
            :..:.:|.....|.:|.|:.|||.|...|.:. :.|:..:::...|...:|.....|...:  ::
Yeast    65 LKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIALPEL--KK 127

  Fly   135 SKGHVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVKVTSISPGLV 199
            :.|:||.::|...:..|:       ....|.::|.|:.........|.|    :||..:::||:|
Yeast   128 TNGNVVFVSSDACNMYFS-------SWGAYGSSKAALNHFAMTLANEER----QVKAIAVAPGIV 181

  Fly   200 DTEL 203
            ||::
Yeast   182 DTDM 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 50/199 (25%)
NADB_Rossmann 1..242 CDD:304358 50/199 (25%)
NRE1NP_012301.3 SPR-like_SDR_c 4..246 CDD:187625 50/199 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341285
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.