DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and AT1G10310

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_563866.1 Gene:AT1G10310 / 837570 AraportID:AT1G10310 Length:242 Species:Arabidopsis thaliana


Alignment Length:211 Identity:54/211 - (25%)
Similarity:94/211 - (44%) Gaps:44/211 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQDRRSRLRIMQCDVSDVSSVNAV 74
            ::||.|.|:|.|:..:|...|..|:..||..::|..|:.||.......|  :..||...|||..:
plant    21 LITGVSKGLGRALALELAKRGHTVIGCARSQEKLTALQSELSSSTNHLL--LTADVKSNSSVEEM 83

  Fly    75 FDAVQGDLGNVDILINNAGKLS-GGQLLTMSVDTVQQMLQTNVMGVVYCTQRAFESMRQRQSKGH 138
            ...:....|..||::||||.:: ..::..:|.:....::.|||.||.                  
plant    84 AHTIVEKKGVPDIIVNNAGTINKNSKIWEVSAEDFDNVMDTNVKGVA------------------ 130

  Fly   139 VVLINSIVGHYIFNPLPGSQQEL-NM--------------YPATKHAITALTELFRQEMRDFKTK 188
                 :::.|:|...||..|..: ||              |.|:|.||..|:....:|:.:   .
plant   131 -----NVLRHFIPLMLPRKQGIIVNMSSGWGRSGAALVAPYCASKWAIEGLSRAVAKEVVE---G 187

  Fly   189 VKVTSISPGLVDTELV 204
            :.|.:::||:::|||:
plant   188 MAVVALNPGVINTELL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 54/211 (26%)
NADB_Rossmann 1..242 CDD:304358 54/211 (26%)
AT1G10310NP_563866.1 SDR_c 20..>205 CDD:212491 54/211 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.