DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and NOL

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_568145.1 Gene:NOL / 830372 AraportID:AT5G04900 Length:348 Species:Arabidopsis thaliana


Alignment Length:237 Identity:73/237 - (30%)
Similarity:117/237 - (49%) Gaps:36/237 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQDRRSRLRIMQCDVSDVSSVNAV 74
            ::||::.|||.|:.|:.:.||..||..:|..:|:|...:.|.::....:...:|||::...|..:
plant    83 LITGSTKGIGYALAREFLKAGDNVVICSRSAERVETAVQSLKEEFGEHVWGTKCDVTEGKDVREL 147

  Fly    75 FDAVQGDLGNVDILINNAGK--LSGGQLLTMSVDTVQQMLQTNVMGVVYCTQRAFESMRQRQSKG 137
            ....|.:|..:||.|||||.  .|...|...|.:.:.::::||.:|::.|.:.|. :|...||:|
plant   148 VAYSQKNLKYIDIWINNAGSNAYSFKPLAEASDEDLIEVVKTNTLGLMLCCREAM-NMMLTQSRG 211

  Fly   138 HVVLINSIVGHYIFN---------PLPGSQQELNMYPATKHAITALTELFRQE--MRDFKTKVKV 191
                     || |||         |.|    ....|.|||.::..||:..:.|  |:|.| .|.|
plant   212 ---------GH-IFNIDGAGSDGRPTP----RFAAYGATKRSVVHLTKSLQAELQMQDVK-NVVV 261

  Fly   192 TSISPGLVDTELVPLDYKGLPMLQAEDVANAIMYVLSTPPHV 233
            .::|||:|.|:|:   ..|....||:...|    ||:.|..|
plant   262 HNLSPGMVTTDLL---MSGATTKQAKFFIN----VLAEPAEV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 73/237 (31%)
NADB_Rossmann 1..242 CDD:304358 73/237 (31%)
NOLNP_568145.1 adh_short 81..276 CDD:278532 65/211 (31%)
SDR_c 82..302 CDD:212491 73/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm1174
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
66.020

Return to query results.
Submit another query.