DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and NYC1

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_567400.1 Gene:NYC1 / 826942 AraportID:AT4G13250 Length:496 Species:Arabidopsis thaliana


Alignment Length:238 Identity:63/238 - (26%)
Similarity:113/238 - (47%) Gaps:44/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQDRR---------SRLRI----- 60
            |:||::.|:|.|:.|:.:.:|..|:..:|..:.::...:||.|:.:         :|.::     
plant   165 VITGSTRGLGKALAREFLLSGDRVIVTSRSSESVDMTVKELEQNLKEIMSNASESARKKLSDAKV 229

  Fly    61 --MQCDVSDVSSVNAVFDAVQGDLGNVDILINNAGKLSGGQ-LLTMSVDTVQQMLQTNVMGVVYC 122
              :.|||.....|..:.:....:||:::|.|||||...|.: ||..:.:.:.|::.||::|.:.|
plant   230 VGIACDVCKPEDVEKLSNFAVKELGSINIWINNAGTNKGFRPLLEFTEEDITQIVSTNLIGSILC 294

  Fly   123 TQRAFESMRQRQSKGHVVLINSIVGHYIFN----PLPGSQQELN-MYPATKHAITALTELFRQEM 182
            |:.|.:.|.::.|.||           |||    ...||...|. :|.:||..:........:|.
plant   295 TRGAMDVMSRQHSGGH-----------IFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGSIVKES 348

  Fly   183 RDFKTKVKVTSISPGLVDTELVPLDYKGLPMLQAEDVANAIMY 225
            :  ||.|.:.:.|||:|.|||         :|....:.|..|:
plant   349 Q--KTNVGLHTASPGMVLTEL---------LLSGSSIKNKQMF 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 63/238 (26%)
NADB_Rossmann 1..242 CDD:304358 63/238 (26%)
NYC1NP_567400.1 SDR_c 164..395 CDD:212491 63/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm1174
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.