DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and AT3G03350

DIOPT Version :10

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001189799.2 Gene:AT3G03350 / 821273 AraportID:AT3G03350 Length:374 Species:Arabidopsis thaliana


Alignment Length:98 Identity:29/98 - (29%)
Similarity:44/98 - (44%) Gaps:10/98 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 SVDTVQQMLQTNVMGVVYCTQRAFESMRQRQSKGHVVLINSIVGHYIFNPLPGSQQELNMYPATK 168
            |.:|:......||.|.:...:.....| .:|..||.|:|:|..|..   |.||..    :|.|:|
plant   265 SEETINTTFDINVFGTITLIKLVTPHM-LKQGGGHFVVISSAAGKV---PSPGQA----IYSASK 321

  Fly   169 HAITALTELFRQEMRDFKTKVKVTSISPGLVDT 201
            ||:.......|.|.  .:..:|||.:.||.::|
plant   322 HALHGYFHSLRSEF--CQEGIKVTVVIPGPIET 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 Rossmann-fold NAD(P)(+)-binding proteins 1..242 CDD:473865 29/98 (30%)
AT3G03350NP_001189799.2 Rossmann-fold NAD(P)(+)-binding proteins <183..208 CDD:473865
Rossmann-fold NAD(P)(+)-binding proteins 207..>366 CDD:473865 29/98 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.