DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and zgc:153724

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001038910.1 Gene:zgc:153724 / 751735 ZFINID:ZDB-GENE-060825-275 Length:131 Species:Danio rerio


Alignment Length:126 Identity:43/126 - (34%)
Similarity:69/126 - (54%) Gaps:12/126 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWHNCVAVVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREE-LPQDRRSRLRIMQCD 64
            |:||...||:|||||:|||||:.:.|:..|:.|:..||.::|:|.|..| :.......|...:||
Zfish     1 MDRWIGRVALVTGASAGIGAAVAKSLVQRGMKVIGCARNVERIENLATECVDCGFTGSLFPYKCD 65

  Fly    65 VSDVSSVNAVFDAVQGDLGNVDILINNA----------GKLSGGQ-LLTMSVDTVQQMLQT 114
            :|....::::|..::.....||:.||||          ||.||.: ::.:|....|..:||
Zfish    66 LSVEEEISSMFAWIKAQHKGVDVCINNAGLALPEPILSGKTSGWRTMIDVSSSNKQVFIQT 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 43/126 (34%)
NADB_Rossmann 1..242 CDD:304358 43/126 (34%)
zgc:153724NP_001038910.1 NADB_Rossmann 1..>115 CDD:304358 39/113 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.