Sequence 1: | NP_001036313.1 | Gene: | CG40485 / 3355165 | FlyBaseID: | FBgn0069973 | Length: | 247 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_079798.2 | Gene: | Dhrs7 / 66375 | MGIID: | 1913625 | Length: | 338 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 59/206 - (28%) |
---|---|---|---|
Similarity: | 103/206 - (50%) | Gaps: | 14/206 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 WH--NCVAVVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQD---RRSRLRIMQC 63
Fly 64 DVSDVSSVNAVFDAVQGDLGNVDILINNAGKLSGGQLLTMSVDTVQQMLQTNVMGVVYCTQRAFE 128
Fly 129 SMRQRQSKGHVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVKVTS 193
Fly 194 ISPGLVDTELV 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG40485 | NP_001036313.1 | YdfG | 1..247 | CDD:226674 | 59/206 (29%) |
NADB_Rossmann | 1..242 | CDD:304358 | 59/206 (29%) | ||
Dhrs7 | NP_079798.2 | 11beta-HSD1_like_SDR_c | 48..308 | CDD:187593 | 58/204 (28%) |
adh_short | 52..249 | CDD:278532 | 58/200 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |