DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and rdh7

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001017189.1 Gene:rdh7 / 549943 XenbaseID:XB-GENE-1194363 Length:318 Species:Xenopus tropicalis


Alignment Length:199 Identity:60/199 - (30%)
Similarity:100/199 - (50%) Gaps:23/199 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQDRRSRLRIMQCDVSDVSSVNAV 74
            ::||..||.|..:.|:|...|:.|:| |...|:..|   :|.::..|||:.:..||:|..||.:|
 Frog    33 LITGCDSGFGNLLARQLDKRGIHVLA-ACLTDKGAQ---DLKKETSSRLQTVILDVTDSKSVCSV 93

  Fly    75 FDAVQGDLGNVDI--LINNAG---KLSGGQLLTMSVDTVQQMLQTNVMGVVYCTQRAFESMRQRQ 134
            .:.|...:||..:  |:||||   ..:..:.||.  :...::|..|::||:..|.:....:  |:
 Frog    94 ANWVSSIVGNKGLWGLVNNAGVSVPSAPNEWLTK--EDFLKILNVNLLGVIDVTIKLLPQV--RK 154

  Fly   135 SKGHVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVKVTSISPGLV 199
            :||.||.:.||.|...|  ..|.      |..:|:.:.:.::..|.||..|  .|||..:.||..
 Frog   155 AKGRVVNVASIAGRLTF--CGGG------YCMSKYGVESFSDSLRHEMAPF--GVKVCMVEPGFF 209

  Fly   200 DTEL 203
            .|::
 Frog   210 KTQV 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 60/199 (30%)
NADB_Rossmann 1..242 CDD:304358 60/199 (30%)
rdh7NP_001017189.1 NADB_Rossmann 30..306 CDD:304358 60/199 (30%)
adh_short 30..221 CDD:278532 60/199 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.