DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and dhrs11

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_012816490.1 Gene:dhrs11 / 496708 XenbaseID:XB-GENE-6048420 Length:255 Species:Xenopus tropicalis


Alignment Length:255 Identity:104/255 - (40%)
Similarity:155/255 - (60%) Gaps:18/255 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWHNCVAVVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQ-DRRSRLRIMQCD 64
            ||||...||:|||||.|||||:.|.|:..|:.||..||.:|::|:|..|... .....|...:||
 Frog     1 MERWKGRVALVTGASVGIGAAVARVLVQHGMKVVGCARSVDKIEKLAAECQSAGYPGTLFPYKCD 65

  Fly    65 VSDVSSVNAVFDAVQGDLGNVDILINNAGKLSGGQLLTMSVDTVQQMLQTNVMGVVYCTQRAFES 129
            :|:...:.::|.|::.....||:.|||||......||:...:..:.|:..||:.:..||:.|::|
 Frog    66 LSNEEEILSMFSAIKTLHQGVDVCINNAGLARPEPLLSGKTEGWRTMIDVNVLALSICTREAYQS 130

  Fly   130 MRQRQ-SKGHVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVKVTS 193
            |::|. ..||::.|||::|| |:.    ..::.:.|.||||.:|||||..|||:|:.|:.::|||
 Frog   131 MKERNIDDGHIININSVLGH-IYQ----CAKQAHFYCATKHTVTALTEAIRQELRELKSHIRVTS 190

  Fly   194 ISPGLVDTE-----------LVPLDYKGLPMLQAEDVANAIMYVLSTPPHVQVHELTIKP 242
            ||||||:||           :....||.:..|...|:|||::|.|.|||||||||:.::|
 Frog   191 ISPGLVETEFAYRCFENDPSIAATLYKSIKCLDPGDIANAVLYALGTPPHVQVHEMIVRP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 104/255 (41%)
NADB_Rossmann 1..242 CDD:304358 103/253 (41%)
dhrs11XP_012816490.1 Mgc4172-like_SDR_c 1..251 CDD:187601 104/255 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 152 1.000 Domainoid score I4278
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 162 1.000 Inparanoid score I4110
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm47935
Panther 1 1.100 - - O PTHR43115
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 1 1.000 - - X367
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.190

Return to query results.
Submit another query.