DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and CG7601

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_651717.1 Gene:CG7601 / 43502 FlyBaseID:FBgn0027583 Length:326 Species:Drosophila melanogaster


Alignment Length:199 Identity:59/199 - (29%)
Similarity:102/199 - (51%) Gaps:13/199 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VAVVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREE---LPQDRRSRLRIMQCDVSDVS 69
            |.::||||||:|.::......||..|:..|||...||:::::   |..|......::..|:::::
  Fly    55 VVLITGASSGLGESLAHVFYRAGCRVILAARRTQELERVKKDLLALDVDPAYPPTVLPLDLAELN 119

  Fly    70 SVNAVFDAVQGDLGNVDILINNAGKLSGGQLLTMSVDTVQQMLQTNVMGVVYCTQRAFESMRQRQ 134
            |:......|......|||||||.|......:.:.:||...:::..|..|.|..|:....||.:|.
  Fly   120 SIPEFVTRVLAVYNQVDILINNGGISVRADVASTAVDVDLKVMVVNYFGSVALTKALLPSMVKRG 184

  Fly   135 SKGHVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVKVTSISPGLV 199
            | ||:..|:|:.|.:   .:|    :...|.|:|||:.|..:..|.|:.:  ..:.|:.:|||.:
  Fly   185 S-GHICFISSVQGKF---AIP----QRAAYSASKHAMQAFADSLRAEVAN--KNINVSCVSPGYI 239

  Fly   200 DTEL 203
            .|:|
  Fly   240 RTQL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 59/199 (30%)
NADB_Rossmann 1..242 CDD:304358 59/199 (30%)
CG7601NP_651717.1 11beta-HSD1_like_SDR_c 51..310 CDD:187593 59/199 (30%)
PRK06181 53..314 CDD:235726 59/199 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435159
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.