DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and Dhrs11

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_038942294.1 Gene:Dhrs11 / 360583 RGDID:1307935 Length:299 Species:Rattus norvegicus


Alignment Length:253 Identity:93/253 - (36%)
Similarity:139/253 - (54%) Gaps:45/253 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWHNCVAVVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREE----------LPQDRR 55
            ||||.:.:|:|||||.|||||:.|.|:..|:.||..||.:..:|:|..|          :|    
  Rat    76 MERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIP---- 136

  Fly    56 SRLRIMQCDVSDVSSVNAVFDAVQGDLGNVDILINNAGKLSGGQLLTMSVDTVQQMLQTNVMGVV 120
                 .:||:|:...:.::|.||:.....|||.|||||......||:.|....:.|...||:.:.
  Rat   137 -----YRCDLSNEEDILSMFSAVRSQHSGVDICINNAGMARPDSLLSGSTSGWKDMFNVNVLALS 196

  Fly   121 YCTQRAFESMRQRQ-SKGHVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRD 184
            .||:.|::||::|. ..||::.|||:.||.:     ..|..::.|.|||:|:|||||..|||:.:
  Rat   197 ICTREAYQSMKERNVDDGHIININSMCGHRV-----PPQSVIHFYSATKYAVTALTEGLRQELLE 256

  Fly   185 FKTKVKVTSISPGLVDTELVPLDYKGLPMLQAEDVANAIMYVLSTPPHVQVHELTIKP 242
            .:|.::.|.:.|                    ||||.|::|||||||||||.::.::|
  Rat   257 AQTHIRATCLRP--------------------EDVAEAVIYVLSTPPHVQVGDIQMRP 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 93/253 (37%)
NADB_Rossmann 1..242 CDD:304358 92/251 (37%)
Dhrs11XP_038942294.1 Mgc4172-like_SDR_c 76..295 CDD:187601 93/253 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337092
Domainoid 1 1.000 151 1.000 Domainoid score I4244
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41560
Inparanoid 1 1.050 188 1.000 Inparanoid score I3811
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm44892
orthoMCL 1 0.900 - - OOG6_100320
Panther 1 1.100 - - O PTHR43115
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.