DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and dhs-6

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001021972.1 Gene:dhs-6 / 3565470 WormBaseID:WBGene00000970 Length:418 Species:Caenorhabditis elegans


Alignment Length:208 Identity:50/208 - (24%)
Similarity:82/208 - (39%) Gaps:37/208 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQL-------REELPQDRRSRLRIMQC--DV 65
            ::||||.|||..|..||...|..:|..|:......:|       .||:   .::..:.:.|  ||
 Worm    13 LITGASRGIGKEIALKLAKDGANIVVAAKTATAHPKLPGTIYSAAEEI---EKAGGKALPCIVDV 74

  Fly    66 SDVSSVNAVFDAVQGDLGNVDILINNAGKLSGGQLLTMSVDTVQQ----MLQTNVMGVVYCTQRA 126
            .|.:||.|..:......|.:|||||||..:|    ||.:.:|..:    |...|..|....|:..
 Worm    75 RDEASVKASVEEAVKKFGGIDILINNASAIS----LTDTENTEMKRYDLMHSINTRGTFLMTKTC 135

  Fly   127 FESMRQRQSKGHVVLINS--------IVGHYIFNP--------LPGSQQELNMYPATKHAITALT 175
            ...::..::. ||:.|:.        ...|..:..        :.|..:|...:....:|:..||
 Worm   136 LPYLKSGKNP-HVLNISPPLLMETRWFANHVAYTMAKYGMSMCVLGQHEEFRPHGIAVNALWPLT 199

  Fly   176 ELFRQEMRDFKTK 188
            .::...|.....|
 Worm   200 AIWTAAMEMLSDK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 50/208 (24%)
NADB_Rossmann 1..242 CDD:304358 50/208 (24%)
dhs-6NP_001021972.1 PRK08278 9..275 CDD:181349 50/208 (24%)
SCP2 319..411 CDD:376720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156015
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.