DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and HSD11B1

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001193670.1 Gene:HSD11B1 / 3290 HGNCID:5208 Length:292 Species:Homo sapiens


Alignment Length:221 Identity:53/221 - (23%)
Similarity:92/221 - (41%) Gaps:37/221 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQDRRSRLRIMQCDVSDVSSVNAV 74
            :|||||.|||..:...|...|..||..||..:.|:::             :..|.....:|.:.:
Human    38 IVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKV-------------VSHCLELGAASAHYI 89

  Fly    75 FDAVQGDLGNVDILINNAGKLSGG--------------QLLTMSVDTVQQMLQTNVMGVVYCTQR 125
            ...:: |:...:..:..||||.||              .|....:..|::.::.|.:..|..|..
Human    90 AGTME-DMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVA 153

  Fly   126 AFESMRQRQSKGHVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVK 190
            |...:  :||.|.:|:::|:.|...: |:..:      |.|:|.|:.......|:|....:..|.
Human   154 ALPML--KQSNGSIVVVSSLAGKVAY-PMVAA------YSASKFALDGFFSSIRKEYSVSRVNVS 209

  Fly   191 VTSISPGLVDTELVPLDYKGLPMLQA 216
            :|....||:|||.......|:..:||
Human   210 ITLCVLGLIDTETAMKAVSGIVHMQA 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 53/221 (24%)
NADB_Rossmann 1..242 CDD:304358 53/221 (24%)
HSD11B1NP_001193670.1 11beta-HSD1_like_SDR_c 32..279 CDD:187593 53/221 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.