DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and CG9360

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster


Alignment Length:254 Identity:124/254 - (48%)
Similarity:175/254 - (68%) Gaps:14/254 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWHNCVAVVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQDRRSRLRIMQCDV 65
            |:||.|.||||||||||||||..:.|:|.|::||.||||.|||::|:..||.|:.||....:|||
  Fly     1 MDRWLNRVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASLPADQASRFHGRKCDV 65

  Fly    66 SDVSSVNAVFDAVQGDLGNVDILINNAGKLSGGQLLTMSVD--TVQQMLQTNVMGVVYCTQRAFE 128
            |....|...|..:...||..|:|:||||.:..|..:|...:  .::.:|.|||:||.:||:.||:
  Fly    66 SQEQEVIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEGNGADLRAILDTNVLGVSWCTREAFK 130

  Fly   129 SMRQRQ-SKGHVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVKVT 192
            |:::|. :.||::::||:.||.:.|. ||.  .:.||..:|:|:|||||:.|||..:.||:.|:|
  Fly   131 SLKRRNVNDGHILIVNSVAGHRVINN-PGI--TMGMYSPSKYAVTALTEVLRQEFHNNKTQTKIT 192

  Fly   193 SISPGLVDTELVPLDYKGL------PMLQAEDVANAIMYVLSTPPHVQVHELTIKPLGE 245
            |||||.||||::  |.:.|      |||::||||:||.|.:.|||:||:|||||||:||
  Fly   193 SISPGAVDTEII--DKEALVGIPDFPMLRSEDVADAISYCIQTPPNVQIHELTIKPVGE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 124/254 (49%)
NADB_Rossmann 1..242 CDD:304358 120/249 (48%)
CG9360NP_572746.1 YdfG 1..250 CDD:226674 124/254 (49%)
NADB_Rossmann 1..246 CDD:304358 120/249 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442641
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
Isobase 1 0.950 - 0 Normalized mean entropy S2090
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D101130at6960
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm6354
orthoMCL 1 0.900 - - OOG6_100320
Panther 1 1.100 - - P PTHR43115
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 1 1.000 - - X367
1312.880

Return to query results.
Submit another query.