DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and CG31548

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster


Alignment Length:196 Identity:49/196 - (25%)
Similarity:96/196 - (48%) Gaps:11/196 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VAVVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQDRRSRLRIMQCDVSDVSSVN 72
            |.::||||||||||...|....|..:....|.::.|:::..|..:..:|:..::..|::..:...
  Fly     7 VVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEADTQ 71

  Fly    73 AVFDAVQGDLGNVDILINNAGKLSGGQLLTMSVDTVQQMLQTNVMGVVYCTQRAFESMRQRQSKG 137
            .::.......|.:|:|:||||.:..|.:.|.|::...:::.||:..:.:.|..|...:  .::||
  Fly    72 RIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPEL--VKTKG 134

  Fly   138 HVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVKVTSISPGLVDTE 202
            ::|.::|:.|   ....||    :..|..:|..:...|.....|:.  ...|:|..::||:..|.
  Fly   135 NIVNVSSVNG---IRSFPG----VLAYNISKMGVDQFTRCVALELA--AKGVRVNCVNPGVTVTN 190

  Fly   203 L 203
            |
  Fly   191 L 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 49/196 (25%)
NADB_Rossmann 1..242 CDD:304358 49/196 (25%)
CG31548NP_730974.1 fabG 1..250 CDD:235975 49/196 (25%)
NADB_Rossmann 3..253 CDD:304358 49/196 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435136
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.