DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and CG10962

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster


Alignment Length:250 Identity:124/250 - (49%)
Similarity:175/250 - (70%) Gaps:4/250 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWHNCVAVVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQDRRSRLRIMQCDV 65
            |:||.|.|||::|||||||||..|.|::||:.||.||||.|||||||:.||.::|.|....:|||
  Fly     1 MDRWQNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQHKCDV 65

  Fly    66 SDVSSVNAVFDAVQGDLGNVDILINNAGKLSGGQLLTMSVDTVQQMLQTNVMGVVYCTQRAFESM 130
            |....|:..|:.::.:||.:|:||||||.:.||||:.|....:..:||||:||.:|||:.|..||
  Fly    66 SQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAASSM 130

  Fly   131 RQRQSKGHVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVKVTSIS 195
            |:||..||::.:||..|...:.|.| :.:.||.|..:|.|:||:.|:.|||:.:..:|:|.|||:
  Fly   131 RRRQVAGHLIFVNSTAGVAGYKPDP-ADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTSIN 194

  Fly   196 PGLVDTELVPLDYK---GLPMLQAEDVANAIMYVLSTPPHVQVHELTIKPLGEPF 247
            ||.|.||:||.:.|   |..:|||:|||.|::|.||||||.||.::|::.:||.|
  Fly   195 PGWVATEIVPDETKAKLGEVILQADDVAQAVLYALSTPPHTQVEQITLRAVGEYF 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 123/248 (50%)
NADB_Rossmann 1..242 CDD:304358 121/243 (50%)
CG10962NP_788887.1 YdfG 1..249 CDD:226674 123/248 (50%)
NADB_Rossmann 1..243 CDD:304358 121/242 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442628
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 1 1.000 - - H41560
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D101130at6960
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm6354
orthoMCL 1 0.900 - - OOG6_100320
Panther 1 1.100 - - P PTHR43115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
1211.900

Return to query results.
Submit another query.