DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and sni

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster


Alignment Length:257 Identity:57/257 - (22%)
Similarity:110/257 - (42%) Gaps:51/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAAITRKLIS---AGVMVVALARRMDRLEQLREELPQDRRSRLRIMQCDVSDVSSV 71
            ::||.:.|:|..:.:.|::   ....:....|..::.::| |:|.:: .|.:.|::.|:.:..:.
  Fly     5 LITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKEL-EDLAKN-HSNIHILEIDLRNFDAY 67

  Fly    72 NAVFDAVQG---DLGNVDILINNAGKLSGGQLLTM-----SVDTVQQMLQTNVMGVVYC------ 122
            :.:...::|   |.| :::|.||||.......:|.     .:||:|......:|....|      
  Fly    68 DKLVADIEGVTKDQG-LNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLPLLKK 131

  Fly   123 TQRAFESMRQRQSKGHVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKT 187
            ..:|.||......:..::.::||:|....|...|    :..|..:|.|:.|.|:....::  :..
  Fly   132 AAKANESQPMGVGRAAIINMSSILGSIQGNTDGG----MYAYRTSKSALNAATKSLSVDL--YPQ 190

  Fly   188 KVKVTSISPGLVDTEL----VPLDYKGLPMLQAEDVANAIMYVLSTPPHVQVHELTIKPLGE 245
            ::...|:.||.|.|::    .|||   :|              .||...||    ||..|||
  Fly   191 RIMCVSLHPGWVKTDMGGSSAPLD---VP--------------TSTGQIVQ----TISKLGE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 57/257 (22%)
NADB_Rossmann 1..242 CDD:304358 54/252 (21%)
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 57/257 (22%)
adh_short 4..209 CDD:278532 44/212 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.