DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and CG3699

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster


Alignment Length:241 Identity:71/241 - (29%)
Similarity:117/241 - (48%) Gaps:33/241 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NCVAVVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQDRRSRLRIMQCDVSDVSS 70
            |.|.:||||||||||||.:.|...|..:..:.|.:..||..::.|   :.::..|:..||:  ..
  Fly     5 NKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSL---KGTQAEIVVADVT--KD 64

  Fly    71 VNAVFDAVQGDLGNVDILINNAGKLSGGQLLTMSVDTVQQMLQTNVMGVVYCTQRAFESMRQRQS 135
            .:|:........|.:|:|:||||.|..|.|:.:.::....:|.||:.||:..|:.....:  .::
  Fly    65 ADAIVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHL--LKT 127

  Fly   136 KGHVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVKVTSISPGLVD 200
            ||.||.::|..|   ..|..|:..    |..:|.|:...|::...||.  ...|:|.|::||.|.
  Fly   128 KGAVVNVSSCAG---IRPFAGALS----YGVSKAALDQFTKIVALEMA--PQGVRVNSVNPGFVV 183

  Fly   201 TE------LVPLDYKGL--------PMLQAED---VANAIMYVLST 229
            |.      :|..:|.|:        ||.:..|   ||.|:.::.|:
  Fly   184 TNIHRNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 71/241 (29%)
NADB_Rossmann 1..242 CDD:304358 71/241 (29%)
CG3699NP_569875.2 fabG 1..244 CDD:235546 71/241 (29%)
NADB_Rossmann 3..248 CDD:304358 71/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435079
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.