DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and CG13377

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001259089.1 Gene:CG13377 / 30972 FlyBaseID:FBgn0261446 Length:330 Species:Drosophila melanogaster


Alignment Length:242 Identity:52/242 - (21%)
Similarity:98/242 - (40%) Gaps:42/242 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VAVVTGASSGIGAAITRKLISAGVMVVA-LARRMDRLE--------QLREELPQDRRSRLRIMQC 63
            |.::|.|.:.:|..:...|.:.|..|.| :....|.|.        ::||...:.....:..|:.
  Fly    47 VVLITSADTALGLQLCTHLANKGYRVFAGMKEAQDSLPAKLLCGWMKIREYSEEPIAGTIIPMRL 111

  Fly    64 DVS--DV-SSVNAVFDA-VQGDLGNVDILINNAGKLSGGQLLTMSVDTVQQMLQTNVMGVVYCTQ 124
            ||:  || .....:..| :..|...:..:||.:|.:..||:.:.:|...:.||:||::|.:. ..
  Fly   112 DVTREDVLREATVIIGANLNADERGIAAVINTSGSVFRGQVESQNVQQWEHMLRTNILGTLR-VA 175

  Fly   125 RAFESMRQRQSKGHVVLINSIVGHYIFNPLPGSQQE----LNMYPATKHAITALTELFRQEMRDF 185
            :||... .|.::|.::.:..:.|       .|:.:.    |..:.|::.|:....|..|:|:..:
  Fly   176 KAFVCF-LRPTRGRLLYLGGVSG-------GGNARNEGDGLVAFNASRVAVDKCAEELRKELHPY 232

  Fly   186 KTKVKVTSISPGLVDTELVPLDYKGL--PMLQAEDVANAIMYVLSTP 230
            ...|              |.||..|:  ..|....||..:..|:..|
  Fly   233 GVSV--------------VALDTCGMTAESLYKAPVAQTMSLVVGAP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 52/242 (21%)
NADB_Rossmann 1..242 CDD:304358 52/242 (21%)
CG13377NP_001259089.1 adh_short 46..246 CDD:278532 47/221 (21%)
NADB_Rossmann 46..>237 CDD:304358 43/212 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435121
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.