DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and Dhrs7

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001258323.1 Gene:Dhrs7 / 299135 RGDID:1565002 Length:338 Species:Rattus norvegicus


Alignment Length:232 Identity:61/232 - (26%)
Similarity:109/232 - (46%) Gaps:29/232 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WH--NCVAVVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQD---RRSRLRIMQC 63
            |.  :.|..:||||||||..:..:|...||.:|..|||...||:::....::   :...:.::..
  Rat    46 WELTDMVVWITGASSGIGEELAFQLSKLGVCLVLSARRGQELERVKRRCLENGNLKEKDILVLPL 110

  Fly    64 DVSDVSSVNAVFDAVQGDLGNVDILINNAGKLSGGQLLTMSVDTVQQMLQTNVMGVVYCTQRAFE 128
            |::|.||..|...||..:.|.:|||:||.|:.....:|..:::..::::..|.:|.|..|:....
  Rat   111 DLTDTSSHEAATKAVLQEFGKIDILVNNGGRSQRSLVLETNLEVFKELMNLNYLGTVSLTKCVLP 175

  Fly   129 SMRQRQSKGHVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVKVTS 193
            .|.:|: :|.:|.:||:.|....:...|       |.|:|||:.........|:..: ..:.:.:
  Rat   176 HMVERK-QGKIVTVNSLAGIASVSLSSG-------YCASKHALRGFFNALHSELGKY-PGITLCN 231

  Fly   194 ISPGLVDTELVPLDYKGLPMLQAEDVANAIMYVLSTP 230
            :.||.|               |:..|.||:...|:.|
  Rat   232 VYPGPV---------------QSNVVKNALTEELTKP 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 61/232 (26%)
NADB_Rossmann 1..242 CDD:304358 61/232 (26%)
Dhrs7NP_001258323.1 11beta-HSD1_like_SDR_c 48..308 CDD:187593 60/230 (26%)
adh_short 52..250 CDD:278532 58/221 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.