DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and rdh8a

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_957001.1 Gene:rdh8a / 280648 ZFINID:ZDB-GENE-021115-3 Length:318 Species:Danio rerio


Alignment Length:227 Identity:67/227 - (29%)
Similarity:108/227 - (47%) Gaps:49/227 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VAVVTGASSGIGAAITRKLI---SAGVMVVALAR---RMDRLEQLREE--------LPQDRRSRL 58
            |.::||.|||||..|...|.   .....|:|..|   :.|||.:...|        ||.|..|..
Zfish     9 VVLITGCSSGIGLRIAVLLARDEQKRYHVIATMRDLKKKDRLVEAAGEVYGQTLTLLPLDICSDE 73

  Fly    59 RIMQCDVSDVSSVNAVFDAVQGDLGNVDILINNAGKLSGGQLLTMSVDTVQQMLQTNVMGVVYCT 123
            .:.||       ||:|.|.      ::|:||||||....|.:.::|:|.::::.:||..|.|...
Zfish    74 SVRQC-------VNSVKDR------HIDVLINNAGVGLLGPVESISMDEMKRVFETNFFGTVRMI 125

  Fly   124 QRAFESMRQRQSKGHVVLINSIVG--HYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFK 186
            :.....|::||: ||:::::|::|  ..:||         ::|.|:|.||....|....::  .|
Zfish   126 KEVMPDMKKRQA-GHIIIMSSVMGLQGVVFN---------DVYTASKFAIEGFCESMAVQL--LK 178

  Fly   187 TKVKVTSISPGLVDT--------ELVPLDYKG 210
            ..||::.|.||.|.|        |:..::|.|
Zfish   179 FNVKLSLIEPGPVHTEFETKMMEEVAKMEYPG 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 67/227 (30%)
NADB_Rossmann 1..242 CDD:304358 67/227 (30%)
rdh8aNP_957001.1 type1_17beta-HSD-like_SDR_c 8..265 CDD:187666 67/227 (30%)
adh_short 8..207 CDD:278532 65/222 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.