DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and DHRS7B

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_011522088.1 Gene:DHRS7B / 25979 HGNCID:24547 Length:334 Species:Homo sapiens


Alignment Length:203 Identity:66/203 - (32%)
Similarity:107/203 - (52%) Gaps:15/203 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NCVAVVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQDRRSRLR-----IMQCDV 65
            |.|.|:|||:||:|....:...:||..:|...|....||:|..||.....::::     ::..|:
Human    99 NAVVVITGATSGLGKECAKVFYAAGAKLVLCGRNGGALEELIRELTASHATKVQTHKPYLVTFDL 163

  Fly    66 SDVSSVNAVFDAVQGDLGNVDILINNAGKLSGGQLLTMSVDTVQQMLQTNVMGVVYCTQRAFESM 130
            :|..::.|....:....|.||||:||||....|.::..:||..:::::||..|.|..|:....||
Human   164 TDSGAIVAAAAEILQCFGYVDILVNNAGISYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPSM 228

  Fly   131 RQRQSKGHVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVKVTSIS 195
            .:|: :||:|.|:||.|..       |....:.|.|:|||..|..:..|.||..:  :::||.||
Human   229 IKRR-QGHIVAISSIQGKM-------SIPFRSAYAASKHATQAFFDCLRAEMEQY--EIEVTVIS 283

  Fly   196 PGLVDTEL 203
            ||.:.|.|
Human   284 PGYIHTNL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 66/203 (33%)
NADB_Rossmann 1..242 CDD:304358 66/203 (33%)
DHRS7BXP_011522088.1 11beta-HSD1_like_SDR_c 97..>304 CDD:187593 66/203 (33%)
adh_short 101..294 CDD:278532 65/201 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.