DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and SPAC521.03

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_593098.1 Gene:SPAC521.03 / 2543461 PomBaseID:SPAC521.03 Length:259 Species:Schizosaccharomyces pombe


Alignment Length:255 Identity:73/255 - (28%)
Similarity:133/255 - (52%) Gaps:23/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWHNCVAVVTGASSGIGAAITRKLIS-AGVMVVALARRMDRLEQLREELPQDRRSRLRIMQCD 64
            |.|......::||||||||.:...::.. |.|.::..|||...:|::.:||.......:..::.|
pombe     1 MSRLDGKTILITGASSGIGKSTAFEIAKVAKVKLILAARRFSTVEEIAKELESKYEVSVLPLKLD 65

  Fly    65 VSDVSSVNAVFDAVQGDLGNVDILINNAG-KLSGGQLLTMSVDTVQQMLQTNVMGVVYCTQRAFE 128
            |||:.|:..|.:::..:..::|:|||||| .|...:::.:::|....|:.|||:|::..| ||..
pombe    66 VSDLKSIPGVIESLPKEFADIDVLINNAGLALGTDKVIDLNIDDAVTMITTNVLGMMAMT-RAVL 129

  Fly   129 SMRQRQSKGHVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVKVTS 193
            .:...::||.::.:.||.|...:  :.||     :|.:||.|:...|...|:|..|  |::::..
pombe   130 PIFYSKNKGDILNVGSIAGRESY--VGGS-----VYCSTKSALAQFTSALRKETID--TRIRIME 185

  Fly   194 ISPGLVDTELVPLD-----------YKGLPMLQAEDVANAIMYVLSTPPHVQVHELTIKP 242
            :.||||:||...:.           ||....|..||:|..|::.|:...:|.:.:..:.|
pombe   186 VDPGLVETEFSVVRFHGDKQKADNVYKNSEPLTPEDIAEVILFALTRRENVVIADTLVFP 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 73/255 (29%)
NADB_Rossmann 1..242 CDD:304358 72/253 (28%)
SPAC521.03NP_593098.1 YdfG 1..249 CDD:226674 73/255 (29%)
SDR_c5 7..256 CDD:187604 71/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41560
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100320
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.