DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and ayr1

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_594548.1 Gene:ayr1 / 2541489 PomBaseID:SPAC23D3.11 Length:296 Species:Schizosaccharomyces pombe


Alignment Length:222 Identity:68/222 - (30%)
Similarity:111/222 - (50%) Gaps:30/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGAS-SGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQDRRSRLRIMQCDVSDVSSVNA 73
            ::||.| .|||.|:..|....|..|:|.||:::|::.|       .::.|:.::.||:|..||..
pombe     8 LITGCSEGGIGNALALKFHQEGFQVLATARQVERMDNL-------TKAGLQTLKLDVTDEDSVRE 65

  Fly    74 VFDAVQG-DLGNVDILINNAGKLSGGQLLTMSVDTVQQMLQTNVMGVVYCTQRAFESMRQRQSKG 137
            |...|:. ..|::..||||||.......:.:.::.|.:::..|..||:. ..:||:....| :||
pombe    66 VEQEVRKFTNGSLHYLINNAGAPCSAPAIDLDIEDVSKVMDVNFYGVIR-MNKAFQHQLIR-AKG 128

  Fly   138 HVVLINSIVGH--YIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVKVTSISPGLVD 200
            .:|.:||:|.:  :.||.         .|.|:|.|:.|.:...|.|:..|  .|:||||..|.|.
pombe   129 TIVNVNSLVSYVPFAFNA---------AYNASKAALLAYSNTLRIELAPF--GVQVTSIMTGGVQ 182

  Fly   201 TEL--VPLDYKGLPMLQAEDVANAIMY 225
            |::  .||.    .|.:|....|:|.|
pombe   183 TKIQSKPLG----TMTEAAIPENSIYY 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 68/222 (31%)
NADB_Rossmann 1..242 CDD:304358 68/222 (31%)
ayr1NP_594548.1 17beta-HSD-like_SDR_c 5..261 CDD:187632 68/222 (31%)
adh_short 5..183 CDD:278532 60/194 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.