DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and Hsd17b1

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_036983.1 Gene:Hsd17b1 / 25322 RGDID:2836 Length:344 Species:Rattus norvegicus


Alignment Length:218 Identity:63/218 - (28%)
Similarity:90/218 - (41%) Gaps:55/218 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VAVVTGASSGIGAAITRKLISAGVMVVALARRMDR---------LEQLREELPQDRRSR------ 57
            |.::||.|||||..:..:|.|            ||         |..|:.:.|....:|      
  Rat     5 VVLITGCSSGIGLHLAVRLAS------------DRSQSFKVYATLRDLKSQGPLLEAARAQGCPP 57

  Fly    58 --LRIMQCDVSDVSSVNAVFDAVQGDLGNVDILINNAGKLSGGQLLTMSVDTVQQMLQTNVMGVV 120
              |.|::.||.|..||.|....|..  |.||:|:.|||:...|.|....::.|..:|..||:|.:
  Rat    58 GSLEILELDVRDSESVAAARACVTE--GRVDVLVCNAGRGLFGPLEAHELNAVGAVLDVNVLGTI 120

  Fly   121 YCTQRAFESMRQRQSKGHVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTE-------LF 178
            ...|.....|::|.| |.|::..|:.|   ...||..:    :|.|:|.|:..|.|       ||
  Rat   121 RMLQAFLPDMKRRHS-GRVLVTASVGG---LMGLPFHE----VYCASKFALEGLCESLAILLPLF 177

  Fly   179 RQEMRDFKTKVKVTSISPGLVDT 201
                     .|.|:.|..|.|.|
  Rat   178 ---------GVHVSLIECGAVHT 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 63/218 (29%)
NADB_Rossmann 1..242 CDD:304358 63/218 (29%)
Hsd17b1NP_036983.1 NADB_Rossmann 4..260 CDD:419666 63/218 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.