Sequence 1: | NP_001036313.1 | Gene: | CG40485 / 3355165 | FlyBaseID: | FBgn0069973 | Length: | 247 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001025461.1 | Gene: | Rdh8 / 235033 | MGIID: | 2685028 | Length: | 317 | Species: | Mus musculus |
Alignment Length: | 264 | Identity: | 68/264 - (25%) |
---|---|---|---|
Similarity: | 113/264 - (42%) | Gaps: | 61/264 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 VVTGASSGIGAAITRKLI---SAGVMVVALARRMDRLEQLREELPQDRRSRLRIMQCDVSDVSSV 71
Fly 72 NAVFDAVQGDLGNVDILINNAGKLSGGQLLTMSVDTVQQMLQTNVMGVVYCTQRAFESMRQRQSK 136
Fly 137 GHVVLINSIVG--HYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVKVTSISPGLV 199
Fly 200 DTELVPLDYKGLPMLQA-----------------------------------EDVANAIMYVLST 229
Fly 230 --PP 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG40485 | NP_001036313.1 | YdfG | 1..247 | CDD:226674 | 68/264 (26%) |
NADB_Rossmann | 1..242 | CDD:304358 | 68/264 (26%) | ||
Rdh8 | NP_001025461.1 | NADB_Rossmann | 6..263 | CDD:304358 | 68/264 (26%) |
adh_short | 6..201 | CDD:278532 | 59/210 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1880 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.930 |