DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and Rdh8

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001025461.1 Gene:Rdh8 / 235033 MGIID:2685028 Length:317 Species:Mus musculus


Alignment Length:264 Identity:68/264 - (25%)
Similarity:113/264 - (42%) Gaps:61/264 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAAITRKLI---SAGVMVVALARRMDRLEQLREELPQDRRSRLRIMQCDVSDVSSV 71
            :::|.|||||..:..:|.   .....|||..|.:.:.|.|.....:.....|.::|.||.:..||
Mouse     9 LISGCSSGIGLELALQLAHDPRQRYQVVATMRDLGKKEPLEAAAGEALGKTLSVVQLDVCNDESV 73

  Fly    72 NAVFDAVQGDLGNVDILINNAGKLSGGQLLTMSVDTVQQMLQTNVMGVVYCTQRAFESMRQRQSK 136
            ......::|  |.||:|:||||....|.|..:|:.|:|.:..||..|.|...:.....|::|: :
Mouse    74 TDCLSHIEG--GQVDVLVNNAGVGLVGPLEGLSLATMQSVFNTNFFGAVRLVKAVLPGMKRRR-Q 135

  Fly   137 GHVVLINSIVG--HYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVKVTSISPGLV 199
            ||:|:::|::|  ..:||         ::|.|:|.|:....|....::|.|  .:.::.:.||.|
Mouse   136 GHIVVVSSVMGLQGVMFN---------DVYAASKFALEGFFESLAIQLRQF--NIFISMVEPGPV 189

  Fly   200 DTELVPLDYKGLPMLQA-----------------------------------EDVANAIMYVLST 229
            .|     |::|..:.|.                                   .|||..|..|:.|
Mouse   190 TT-----DFEGKLLAQVSKAEFPDTDPDTLGYFRDLYLPASRELFRSVGQSPRDVAQVIAKVIGT 249

  Fly   230 --PP 231
              ||
Mouse   250 TRPP 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 68/264 (26%)
NADB_Rossmann 1..242 CDD:304358 68/264 (26%)
Rdh8NP_001025461.1 NADB_Rossmann 6..263 CDD:304358 68/264 (26%)
adh_short 6..201 CDD:278532 59/210 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.