DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and Dhrs11

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_808232.2 Gene:Dhrs11 / 192970 MGIID:2652816 Length:260 Species:Mus musculus


Alignment Length:264 Identity:101/264 - (38%)
Similarity:151/264 - (57%) Gaps:36/264 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWHNCVAVVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREE----------LPQDRR 55
            ||||.:.:|:|||||.|||||:.|.|:..|:.||..||.:..:|:|..|          :|    
Mouse     6 MERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIP---- 66

  Fly    56 SRLRIMQCDVSDVSSVNAVFDAVQGDLGNVDILINNAGKLSGGQLLTMSVDTVQQMLQTNVMGVV 120
                 .:||:|:...:.::|.||:.....|||.|||||......||:.|....:.|...||:.:.
Mouse    67 -----YRCDLSNEEDILSMFSAVRSQHSGVDICINNAGMARPDTLLSGSTSGWKDMFNVNVLALS 126

  Fly   121 YCTQRAFESMRQRQ-SKGHVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRD 184
            .||:.|::||::|. ..||::.|||:.||.:     ..|..::.|.|||:|:|||||..|||:.:
Mouse   127 ICTREAYQSMKERNIDDGHIININSMCGHRV-----PPQSVIHFYSATKYAVTALTEGLRQELLE 186

  Fly   185 FKTKVKVTSISPGLVDTEL-----------VPLDYKGLPMLQAEDVANAIMYVLSTPPHVQVHEL 238
            .:|.::.|.||||||:|:.           ....|:.:..|:.||||.|::|||||||||||.::
Mouse   187 AQTHIRATCISPGLVETQFAFKLHDKDPGEAAATYEHIKCLRPEDVAEAVIYVLSTPPHVQVGDI 251

  Fly   239 TIKP 242
            .::|
Mouse   252 QMRP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 101/264 (38%)
NADB_Rossmann 1..242 CDD:304358 100/262 (38%)
Dhrs11NP_808232.2 YdfG 6..259 CDD:226674 101/264 (38%)
Mgc4172-like_SDR_c 6..256 CDD:187601 101/264 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833537
Domainoid 1 1.000 151 1.000 Domainoid score I4330
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41560
Inparanoid 1 1.050 188 1.000 Inparanoid score I3893
Isobase 1 0.950 - 0 Normalized mean entropy S2090
OMA 1 1.010 - - QHG45743
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm42824
orthoMCL 1 0.900 - - OOG6_100320
Panther 1 1.100 - - O PTHR43115
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 1 1.000 - - X367
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.830

Return to query results.
Submit another query.