DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and R05D8.9

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_503753.1 Gene:R05D8.9 / 187609 WormBaseID:WBGene00019886 Length:281 Species:Caenorhabditis elegans


Alignment Length:261 Identity:67/261 - (25%)
Similarity:113/261 - (43%) Gaps:54/261 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWHNCVAVVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREEL-----PQDRRSRLRI 60
            :.|:...||:|||:|:|||.|........|..|....|..:|||:.|:|:     |:   |.:..
 Worm     2 LSRFSGKVALVTGSSNGIGRAAAVLFAKDGAKVTVTGRNAERLEETRQEILKSGVPE---SHVLS 63

  Fly    61 MQCDVSDVSSVNAVFDAVQGDLGNVDILINNAGKL----SGGQLLTMSVDTVQQMLQTNVMGVVY 121
            :..|::.....:.:.::.....|.:|||:||||..    .|...:...|....:::|.|:..||.
 Worm    64 VATDLAAEKGQDELVNSTIQKFGRLDILVNNAGAAFNDDQGRVGVDQDVSVYDKIMQINMRSVVT 128

  Fly   122 CTQRAFESMRQRQSKGHVVLINSIVG--HYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRD 184
            .||:|.|.:  .::||.:|.::||.|  |        :|..:..|..:|.|:...|.....::..
 Worm   129 LTQKAKEHL--VKAKGEIVNVSSIAGTAH--------AQPGVMYYAMSKSALDQFTRCAAIDLIQ 183

  Fly   185 FKTKVKVTSISPGLVDT------------------------ELVPLDYKGLPMLQAEDVANAIMY 225
            :  .|:|.|:|||.|.|                        |.:|......|:    |:||.|.:
 Worm   184 Y--GVRVNSVSPGGVTTGFGEAMGMPSGAFEEMMKFMESRKECIPSGAVAKPI----DIANIIAF 242

  Fly   226 V 226
            :
 Worm   243 L 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 67/261 (26%)
NADB_Rossmann 1..242 CDD:304358 67/261 (26%)
R05D8.9NP_503753.1 fabG 4..266 CDD:235975 67/259 (26%)
NADB_Rossmann 5..266 CDD:304358 66/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D460854at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.