DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and F20G2.2

DIOPT Version :9

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_506407.1 Gene:F20G2.2 / 184743 WormBaseID:WBGene00008986 Length:249 Species:Caenorhabditis elegans


Alignment Length:234 Identity:53/234 - (22%)
Similarity:103/234 - (44%) Gaps:36/234 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQDRRSRLRIMQCDVSDVSSVNAV 74
            ::|||:.|||..:.::.:....:.:.:|...|  ....|||...:.|||.|:..|:....|::.:
 Worm     7 LITGANRGIGLGLLKQFLKHKDIQIIIATCRD--PSKAEELSNLKDSRLHILPLDIDCDESISKL 69

  Fly    75 FDAVQGDLG--NVDILINNAGKLSGGQLLTMSVD------TVQQMLQTNVMGVVYCTQRAFESMR 131
            :..|:..:|  .:.:|:|||     |.||...|:      |:.:.|:||.:.....||.....::
 Worm    70 YAEVEKLVGEDGLTVLLNNA-----GILLPYDVEGEKNRKTLIRQLETNSVSTALITQEFLPLLK 129

  Fly   132 QRQSK----GHVVLINSIVGHYIFNPLPGSQQELN--------MYPATKHAITALTELFRQEMRD 184
            :..:|    |:.:...:||.   .:....|.::::        .|..:|.|:.:..:....::. 
 Worm   130 KAAAKNGGDGYSINRAAIVN---ISSTAASVEKIDGTFNGPLVAYRMSKSALNSFAKSCSIDLA- 190

  Fly   185 FKTKVKVTSISPGLVDTELVPLDYKGLPMLQAEDVANAI 223
             |..:.|||..||.|.|.:...:    .||:.||....:
 Worm   191 -KYHILVTSFCPGWVKTGMGGAN----AMLEIEDATKTL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 53/234 (23%)
NADB_Rossmann 1..242 CDD:304358 53/234 (23%)
F20G2.2NP_506407.1 carb_red_sniffer_like_SDR_c 7..248 CDD:187586 53/234 (23%)
adh_short 7..208 CDD:278532 49/212 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160155952
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.