DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40485 and C33E10.10

DIOPT Version :10

Sequence 1:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_510806.1 Gene:C33E10.10 / 183165 WormBaseID:WBGene00016350 Length:135 Species:Caenorhabditis elegans


Alignment Length:38 Identity:10/38 - (26%)
Similarity:20/38 - (52%) Gaps:4/38 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 YPATKHAITALTELFRQEMRDFKTKVKVTSISPGLVDT 201
            |.|:|||:....:..|.|.::    :.:..:|.|.::|
 Worm    16 YSASKHALQGYFDCLRAEHKN----LHILVVSAGYINT 49

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40485NP_001036313.1 Rossmann-fold NAD(P)(+)-binding proteins 1..242 CDD:473865 10/38 (26%)
C33E10.10NP_510806.1 Rossmann-fold NAD(P)(+)-binding proteins <15..115 CDD:473865 10/38 (26%)

Return to query results.
Submit another query.